PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016484782.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family B3
Protein Properties Length: 374aa    MW: 43296.2 Da    PI: 6.7866
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016484782.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B334.15e-111523690
                    EEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
              B3 36 ltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90
                    ++l+de+ r W v++     + ++ +t+GW++F +an++++gD+  F+l+++ ++
  XP_016484782.1  1 MILRDEKQRLWPVQV--GPLGHHFAITRGWRQFREANNVQVGDTYKFELIDN-GT 52
                    579************..999999*************************9984.33 PP

2B348.12.1e-15891651299
                     HTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
              B3  12 ksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                     k ++l +p+ f+ ++ +g   e+++  +  + +++W+vk+  ++++    l++GW++F+++++L+ gD +vF+++g++ef   v++f++
  XP_016484782.1  89 K-KQLKIPRGFL-KYlKGH--EDIEHAVLRRVSKQWQVKV--NGRR----LEDGWEKFAEEHDLQLGDLLVFRHEGNMEF--EVSIFDS 165
                     4.469*******.664666..6788999999*********..8888....*************************99999..9999986 PP

3B354.71.8e-17227307587
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                     +++++ l+ g l++pk+fa+++g k++++  l+++de+ +sW+++l  + ++ ++++++G ++Fv +n LkegD ++F+++ +
  XP_016484782.1 227 TIKPYCLTYGFLYVPKHFASANGFKTNKKCSLIIKDERQNSWTLRL--SCCKTQVYIGDGCRKFVADNCLKEGDRIMFEVVTD 307
                     678999999*************888888889***************..888888*************************7653 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF023622.5E-9159IPR003340B3 DNA binding domain
SuperFamilySSF1019363.34E-12158IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.901161IPR003340B3 DNA binding domain
CDDcd100172.83E-9160No hitNo description
Gene3DG3DSA:2.40.330.102.8E-11158IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.60577166IPR003340B3 DNA binding domain
SMARTSM010193.0E-1381166IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.8E-1887168IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.49E-1887168IPR015300DNA-binding pseudobarrel domain
CDDcd100174.73E-1489164No hitNo description
PfamPF023627.5E-1289165IPR003340B3 DNA binding domain
SuperFamilySSF1019368.04E-19220316IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.2E-18221315IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.377223318IPR003340B3 DNA binding domain
SMARTSM010194.9E-14224319IPR003340B3 DNA binding domain
PfamPF023628.7E-16227308IPR003340B3 DNA binding domain
CDDcd100177.25E-13228303No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MILRDEKQRL WPVQVGPLGH HFAITRGWRQ FREANNVQVG DTYKFELIDN GTIPVAHFYS  60
ENALGCYNIL QVNILGRMPS IREVIDNVKK QLKIPRGFLK YLKGHEDIEH AVLRRVSKQW  120
QVKVNGRRLE DGWEKFAEEH DLQLGDLLVF RHEGNMEFEV SIFDSSHCDR EYSEYLQQEE  180
EEEEANNVEE TSKNLEFEER PSPSIELSDH AEAATHKPFG HSSFVCTIKP YCLTYGFLYV  240
PKHFASANGF KTNKKCSLII KDERQNSWTL RLSCCKTQVY IGDGCRKFVA DNCLKEGDRI  300
MFEVVTDGEI PVWKFHVVTD AETPRQKFQK NATEKPEPNI MSSHKVFPDA EACKDVPLGR  360
PHLISTVKLL RKPN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016484782.10.0PREDICTED: B3 domain-containing protein REM10-like, partial
TrEMBLK4CIA91e-106K4CIA9_SOLLC; Uncharacterized protein
STRINGSolyc08g006200.1.11e-106(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA32215171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24700.13e-25B3 family protein